Lineage for d2byoa1 (2byo A:20-207)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433195Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 2433196Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 2433234Family b.125.1.3: LppX-like [141566] (1 protein)
    Pfam PF07161; DUF1396; contains a large cavity between the 'flattened' beta-sheet and helix-containing loops
  6. 2433235Protein Putative lipoprotein LppX [141567] (1 species)
  7. 2433236Species Mycobacterium tuberculosis [TaxId:1773] [141568] (1 PDB entry)
    Uniprot P65306 46-233
  8. 2433237Domain d2byoa1: 2byo A:20-207 [129497]
    complexed with act, hxa, lnl, mlt, oaa, zn

Details for d2byoa1

PDB Entry: 2byo (more details), 2.15 Å

PDB Description: crystal structure of mycobacterium tuberculosis lipoprotein lppx (rv2945c)
PDB Compounds: (A:) lipoprotein lppx

SCOPe Domain Sequences for d2byoa1:

Sequence, based on SEQRES records: (download)

>d2byoa1 b.125.1.3 (A:20-207) Putative lipoprotein LppX {Mycobacterium tuberculosis [TaxId: 1773]}
sdpallaeirqsldatkgltsvhvavrttgkvdsllgitsadvdvranplaakgvctynd
eqgvpfrvqgdnisvklfddwsnlgsiselstsrvldpaagvtqllsgvtnlqaqgtevi
dgisttkitgtipassvkmldpgaksarpatvwiaqdgshhlvrasidlgsgsiqltqsk
wnepvnvd

Sequence, based on observed residues (ATOM records): (download)

>d2byoa1 b.125.1.3 (A:20-207) Putative lipoprotein LppX {Mycobacterium tuberculosis [TaxId: 1773]}
sdpallaeirqsldatkgltsvhvavrttgkvdsllgitsadvdvranplaakgvctynd
eqgvpfrvqgdnisvklfddwsnlgsiselstsrvgvtqllsgvtnlqaqgtevidgist
tkitgtipassvkmldpgaksarpatvwiaqdgshhlvrasidlgsgsiqltqskwnepv
nvd

SCOPe Domain Coordinates for d2byoa1:

Click to download the PDB-style file with coordinates for d2byoa1.
(The format of our PDB-style files is described here.)

Timeline for d2byoa1: