Lineage for d2bymd1 (2bym D:12-97)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 765181Family a.22.1.3: TBP-associated factors, TAFs [47134] (13 proteins)
  6. 765182Protein Chrac-14 [140398] (1 species)
  7. 765183Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140399] (2 PDB entries)
    Uniprot Q9V444 11-99
  8. 765187Domain d2bymd1: 2bym D:12-97 [129496]
    Other proteins in same PDB: d2byma1, d2bymc1
    automatically matched to 2BYK B:11-99
    complexed with cd

Details for d2bymd1

PDB Entry: 2bym (more details), 2.8 Å

PDB Description: histone fold heterodimer of the chromatin accessibility complex
PDB Compounds: (D:) chrac-14

SCOP Domain Sequences for d2bymd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bymd1 a.22.1.3 (D:12-97) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
navigrlikealpesasvskearaaiaraasvfaifvtssstalahkqnhktitakdilq
tlteldfesfvpsltqdlevyrkvvk

SCOP Domain Coordinates for d2bymd1:

Click to download the PDB-style file with coordinates for d2bymd1.
(The format of our PDB-style files is described here.)

Timeline for d2bymd1: