SCOPe 2.07: Domain d2bymb_: 2bym B:

Lineage for d2bymb_ (2bym B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)

6. Protein Chrac-14 [140398] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140399] (2 PDB entries)
   Uniprot Q9V444 11-99

8. Domain d2bymb_: 2bym B: [129494]
   Other proteins in same PDB: d2byma_, d2bymc_
   automated match to d2bykb1
   protein/DNA complex; complexed with cd

Details for d2bymb_

PDB Entry: 2bym, 2.8 Å

PDB Description: histone fold heterodimer of the chromatin accessibility complex

PDB Compounds: (B:) chrac-14

SCOPe Domain Sequences for d2bymb_:

Sequence; same for both SEQRES and ATOM records:

>d2bymb_ a.22.1.3 (B:) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
avigrlikealpesasvskearaaiaraasvfaifvtssstalahkqnhktitakdilqt
lteldfesfvpsltqdlevyrkv

Timeline for d2bymb_:

• d2bymb_ first appeared in SCOP 1.73, called d2bymb1
  
• d2bymb_ appears in SCOPe 2.06
  
• d2bymb_ appears in the current release, SCOPe 2.08