SCOP 1.73: Domain d2bylb1: 2byl B:36-439

Lineage for d2bylb1 (2byl B:36-439)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (8 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Ornithine aminotransferase [53422] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53423] (6 PDB entries)

8. Domain d2bylb1: 2byl B:36-439 [129491]
   automatically matched to 2BYL A:36-439
   complexed with plp; mutant

Details for d2bylb1

PDB Entry: 2byl, 2.15 Å

PDB Description: Structure of ornithine aminotransferase triple mutant Y85I Y55A G320F

PDB Compounds: (B:) ornithine aminotransferase

SCOP Domain Sequences for d2bylb1:

Sequence; same for both SEQRES and ATOM records:

>d2bylb1 c.67.1.4 (B:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]}
gpptsddifereykygahnahplpvalergkgiylwdvegrkyfdflssisavnqghchp
kivnalksqvdkltltsrafynnvlgeyeeyitklfnyhkvlpmntgveagetacklark
wgytvkgiqkykakivfaagnfwgrtlsaissstdptsydgfgpfmpgfdiipyndlpal
eralqdpnvaafmvepiqgeagvvvpdpgylmgvrelctrhqvlfiadeiqtglartgrw
lavdyenvrpdivllgkalsgglypvsavlcdddimltikpgehfstyggnplgcrvaia
alevleeenlaenadklgiilrnelmklpsdvvtavrgkgllnaiviketkdwdawkvcl
rlrdngllakpthgdiirfapplvikedelresieiinktilsf

Timeline for d2bylb1:

• d2bylb1 is new in SCOP 1.73
  
• d2bylb1 appears in SCOP 1.75
  
• d2bylb1 appears in the current release, SCOPe 2.08, called d2bylb_