| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.3: TBP-associated factors, TAFs [47134] (13 proteins) |
| Protein Chrac-14 [140398] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140399] (2 PDB entries) Uniprot Q9V444 11-99 |
| Domain d2bykd1: 2byk D:11-98 [129489] Other proteins in same PDB: d2byka1, d2bykc1 automatically matched to 2BYK B:11-99 protein/DNA complex; complexed with so4 |
PDB Entry: 2byk (more details), 2.4 Å
SCOPe Domain Sequences for d2bykd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bykd1 a.22.1.3 (D:11-98) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pnavigrlikealpesasvskearaaiaraasvfaifvtssstalahkqnhktitakdil
qtlteldfesfvpsltqdlevyrkvvke
Timeline for d2bykd1: