Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
Protein Chrac-16 [140400] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140401] (2 PDB entries) Uniprot Q9V452 29-100 |
Domain d2bykc_: 2byk C: [129488] Other proteins in same PDB: d2bykb1, d2bykd_ automated match to d2byka1 protein/DNA complex; complexed with so4 |
PDB Entry: 2byk (more details), 2.4 Å
SCOPe Domain Sequences for d2bykc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bykc_ a.22.1.3 (C:) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mdtglitnevlflmtkctelfvrhlagaayteefgqrpgealkyehlsqvvnknknlefl lqivpq
Timeline for d2bykc_: