Lineage for d2bykc_ (2byk C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1988031Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 1988038Protein Chrac-16 [140400] (1 species)
  7. 1988039Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140401] (2 PDB entries)
    Uniprot Q9V452 29-100
  8. 1988041Domain d2bykc_: 2byk C: [129488]
    Other proteins in same PDB: d2bykb1, d2bykd_
    automated match to d2byka1
    protein/DNA complex; complexed with so4

Details for d2bykc_

PDB Entry: 2byk (more details), 2.4 Å

PDB Description: histone fold heterodimer of the chromatin accessibility complex
PDB Compounds: (C:) chrac-16

SCOPe Domain Sequences for d2bykc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bykc_ a.22.1.3 (C:) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mdtglitnevlflmtkctelfvrhlagaayteefgqrpgealkyehlsqvvnknknlefl
lqivpq

SCOPe Domain Coordinates for d2bykc_:

Click to download the PDB-style file with coordinates for d2bykc_.
(The format of our PDB-style files is described here.)

Timeline for d2bykc_: