Lineage for d2bykc1 (2byk C:33-98)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 765181Family a.22.1.3: TBP-associated factors, TAFs [47134] (13 proteins)
  6. 765188Protein Chrac-16 [140400] (1 species)
  7. 765189Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140401] (2 PDB entries)
    Uniprot Q9V452 29-100
  8. 765191Domain d2bykc1: 2byk C:33-98 [129488]
    Other proteins in same PDB: d2bykb1, d2bykd1
    automatically matched to 2BYK A:29-100
    complexed with so4

Details for d2bykc1

PDB Entry: 2byk (more details), 2.4 Å

PDB Description: histone fold heterodimer of the chromatin accessibility complex
PDB Compounds: (C:) chrac-16

SCOP Domain Sequences for d2bykc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bykc1 a.22.1.3 (C:33-98) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mdtglitnevlflmtkctelfvrhlagaayteefgqrpgealkyehlsqvvnknknlefl
lqivpq

SCOP Domain Coordinates for d2bykc1:

Click to download the PDB-style file with coordinates for d2bykc1.
(The format of our PDB-style files is described here.)

Timeline for d2bykc1: