SCOPe 2.08: Domain d2byga1: 2byg A:190-283

Lineage for d2byga1 (2byg A:190-283)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Channel associated protein of synapse-110 [141273] (1 species)
   Discs large homolog 2, PSD-93

7. Species Human (Homo sapiens) [TaxId:9606] [141274] (1 PDB entry)
   Uniprot Q15700 190-283

8. Domain d2byga1: 2byg A:190-283 [129480]
   Other proteins in same PDB: d2byga2

Details for d2byga1

PDB Entry: 2byg, 1.85 Å

PDB Description: 2nd pdz domain of discs large homologue 2

PDB Compounds: (A:) channel associated protein of synapse-110

SCOPe Domain Sequences for d2byga1:

Sequence; same for both SEQRES and ATOM records:

>d2byga1 b.36.1.1 (A:190-283) Channel associated protein of synapse-110 {Human (Homo sapiens) [TaxId: 9606]}
tvveiklfkgpkglgfsiaggvgnqhipgdnsiyvtkiidggaaqkdgrlqvgdrllmvn
nysleevtheeavailkntsevvylkvgkpttiy

Timeline for d2byga1:

• d2byga1 first appeared in SCOP 1.73
  
• d2byga1 appears in SCOPe 2.07