![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein Channel associated protein of synapse-110 [141273] (1 species) Discs large homolog 2, PSD-93 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141274] (1 PDB entry) Uniprot Q15700 190-283 |
![]() | Domain d2byga1: 2byg A:190-283 [129480] Other proteins in same PDB: d2byga2 |
PDB Entry: 2byg (more details), 1.85 Å
SCOPe Domain Sequences for d2byga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2byga1 b.36.1.1 (A:190-283) Channel associated protein of synapse-110 {Human (Homo sapiens) [TaxId: 9606]} tvveiklfkgpkglgfsiaggvgnqhipgdnsiyvtkiidggaaqkdgrlqvgdrllmvn nysleevtheeavailkntsevvylkvgkpttiy
Timeline for d2byga1: