Lineage for d2byfa1 (2byf A:1-116)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717441Family d.15.1.5: Ras-binding domain, RBD [54263] (13 proteins)
    contains Pfam PF00788 and Pfam 02196
  6. 717469Protein Phospholipase C-epsilon-1 [142966] (1 species)
    contains several Ras-binding domains; some are 'hidden' in the sequence
  7. 717470Species Human (Homo sapiens) [TaxId:9606] [142967] (3 PDB entries)
  8. 717473Domain d2byfa1: 2byf A:1-116 [129479]
    mutant

Details for d2byfa1

PDB Entry: 2byf (more details)

PDB Description: nmr solution structure of phospholipase c epsilon ra 2 domain
PDB Compounds: (A:) phospholipase c, epsilon 1

SCOP Domain Sequences for d2byfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byfa1 d.15.1.5 (A:1-116) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]}
sseeesffvqvhdvspeqpltvikaprvstaqdviqqtlckakysysilsnpnpsdyvll
eevvkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeqvqasredk

SCOP Domain Coordinates for d2byfa1:

Click to download the PDB-style file with coordinates for d2byfa1.
(The format of our PDB-style files is described here.)

Timeline for d2byfa1: