Lineage for d2bycb_ (2byc B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909557Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 1909595Family d.58.10.2: BLUF domain [143364] (4 proteins)
    Pfam PF04940; sensors of blue-light using FAD
  6. 1909596Protein Blue light receptor BlrB [143365] (1 species)
  7. 1909597Species Rhodobacter sphaeroides [TaxId:1063] [143366] (1 PDB entry)
    Uniprot Q3IYE4 1-136
  8. 1909599Domain d2bycb_: 2byc B: [129477]
    automated match to d2byca1
    complexed with fmn

Details for d2bycb_

PDB Entry: 2byc (more details), 1.9 Å

PDB Description: blrb - a bluf protein, dark state structure
PDB Compounds: (B:) blue-light receptor of the bluf-family

SCOPe Domain Sequences for d2bycb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bycb_ d.58.10.2 (B:) Blue light receptor BlrB {Rhodobacter sphaeroides [TaxId: 1063]}
fmdelvsltyrsrvrladpvadivqimrasrvrnlrlgitgillyngvhfvqtiegprsa
cdelfrlisadprhqeilafdlepitarrfpdwsmrivsrkelralapdlerldlsgped
vaelhrtiaasl

SCOPe Domain Coordinates for d2bycb_:

Click to download the PDB-style file with coordinates for d2bycb_.
(The format of our PDB-style files is described here.)

Timeline for d2bycb_: