Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) |
Family d.58.10.2: BLUF domain [143364] (4 proteins) Pfam PF04940; sensors of blue-light using FAD |
Protein Blue light receptor BlrB [143365] (1 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [143366] (1 PDB entry) Uniprot Q3IYE4 1-136 |
Domain d2bycb_: 2byc B: [129477] automated match to d2byca1 complexed with fmn |
PDB Entry: 2byc (more details), 1.9 Å
SCOPe Domain Sequences for d2bycb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bycb_ d.58.10.2 (B:) Blue light receptor BlrB {Rhodobacter sphaeroides [TaxId: 1063]} fmdelvsltyrsrvrladpvadivqimrasrvrnlrlgitgillyngvhfvqtiegprsa cdelfrlisadprhqeilafdlepitarrfpdwsmrivsrkelralapdlerldlsgped vaelhrtiaasl
Timeline for d2bycb_: