SCOP 1.73: Domain d2bycb1: 2byc B:501-631

Lineage for d2bycb1 (2byc B:501-631)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (2 families)

5. Family d.58.10.2: BLUF domain [143364] (3 proteins)
   Pfam PF04940; sensors of blue-light using FAD

6. Protein Blue light receptor BlrB [143365] (1 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [143366] (1 PDB entry)

8. Domain d2bycb1: 2byc B:501-631 [129477]
   automatically matched to 2BYC A:1-136
   complexed with fmn

Details for d2bycb1

PDB Entry: 2byc, 1.9 Å

PDB Description: blrb - a bluf protein, dark state structure

PDB Compounds: (B:) blue light sensing

SCOP Domain Sequences for d2bycb1:

Sequence; same for both SEQRES and ATOM records:

>d2bycb1 d.58.10.2 (B:501-631) Blue light receptor BlrB {Rhodobacter sphaeroides [TaxId: 1063]}
mdelvsltyrsrvrladpvadivqimrasrvrnlrlgitgillyngvhfvqtiegprsac
delfrlisadprhqeilafdlepitarrfpdwsmrivsrkelralapdlerldlsgpedv
aelhrtiaasl

Timeline for d2bycb1:

• d2bycb1 is new in SCOP 1.73
  
• d2bycb1 appears in SCOP 1.75
  
• d2bycb1 appears in the current release, SCOPe 2.08, called d2bycb2