SCOPe 2.08: Domain d2bycb2: 2byc B:501-631

Lineage for d2bycb2 (2byc B:501-631)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families)

5. Family d.58.10.2: BLUF domain [143364] (4 proteins)
   Pfam PF04940; sensors of blue-light using FAD

6. Protein Blue light receptor BlrB [143365] (1 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [143366] (1 PDB entry)
   Uniprot Q3IYE4 1-136

8. Domain d2bycb2: 2byc B:501-631 [129477]
   Other proteins in same PDB: d2byca2, d2bycb3
   automated match to d2byca1
   complexed with fmn

Details for d2bycb2

PDB Entry: 2byc, 1.9 Å

PDB Description: blrb - a bluf protein, dark state structure

PDB Compounds: (B:) blue-light receptor of the bluf-family

SCOPe Domain Sequences for d2bycb2:

Sequence; same for both SEQRES and ATOM records:

>d2bycb2 d.58.10.2 (B:501-631) Blue light receptor BlrB {Rhodobacter sphaeroides [TaxId: 1063]}
mdelvsltyrsrvrladpvadivqimrasrvrnlrlgitgillyngvhfvqtiegprsac
delfrlisadprhqeilafdlepitarrfpdwsmrivsrkelralapdlerldlsgpedv
aelhrtiaasl

Timeline for d2bycb2:

• d2bycb2 first appeared in SCOP 1.73, called d2bycb1
  
• d2bycb2 appears in SCOPe 2.07