SCOPe 2.03: Domain d2byca1: 2byc A:1-136

Lineage for d2byca1 (2byc A:1-136)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families)

5. Family d.58.10.2: BLUF domain [143364] (4 proteins)
   Pfam PF04940; sensors of blue-light using FAD

6. Protein Blue light receptor BlrB [143365] (1 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [143366] (1 PDB entry)
   Uniprot Q3IYE4 1-136

8. Domain d2byca1: 2byc A:1-136 [129476]
   complexed with fmn

Details for d2byca1

PDB Entry: 2byc, 1.9 Å

PDB Description: blrb - a bluf protein, dark state structure

PDB Compounds: (A:) blue-light receptor of the bluf-family

SCOPe Domain Sequences for d2byca1:

Sequence; same for both SEQRES and ATOM records:

>d2byca1 d.58.10.2 (A:1-136) Blue light receptor BlrB {Rhodobacter sphaeroides [TaxId: 1063]}
mdelvsltyrsrvrladpvadivqimrasrvrnlrlgitgillyngvhfvqtiegprsac
delfrlisadprhqeilafdlepitarrfpdwsmrivsrkelralapdlerldlsgpedv
aelhrtiaaslsrgda

Timeline for d2byca1:

• d2byca1 first appeared in SCOP 1.73
  
• d2byca1 appears in SCOPe 2.02
  
• d2byca1 appears in SCOPe 2.04
  
• d2byca1 appears in the current release, SCOPe 2.08