Lineage for d2byca1 (2byc A:1-136)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862748Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (2 families) (S)
  5. 862769Family d.58.10.2: BLUF domain [143364] (3 proteins)
    Pfam PF04940; sensors of blue-light using FAD
  6. 862770Protein Blue light receptor BlrB [143365] (1 species)
  7. 862771Species Rhodobacter sphaeroides [TaxId:1063] [143366] (1 PDB entry)
    Uniprot Q3IYE4 1-136
  8. 862772Domain d2byca1: 2byc A:1-136 [129476]
    complexed with fmn

Details for d2byca1

PDB Entry: 2byc (more details), 1.9 Å

PDB Description: blrb - a bluf protein, dark state structure
PDB Compounds: (A:) blue light sensing

SCOP Domain Sequences for d2byca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byca1 d.58.10.2 (A:1-136) Blue light receptor BlrB {Rhodobacter sphaeroides [TaxId: 1063]}
mdelvsltyrsrvrladpvadivqimrasrvrnlrlgitgillyngvhfvqtiegprsac
delfrlisadprhqeilafdlepitarrfpdwsmrivsrkelralapdlerldlsgpedv
aelhrtiaaslsrgda

SCOP Domain Coordinates for d2byca1:

Click to download the PDB-style file with coordinates for d2byca1.
(The format of our PDB-style files is described here.)

Timeline for d2byca1: