![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) ![]() |
![]() | Family d.58.10.2: BLUF domain [143364] (4 proteins) Pfam PF04940; sensors of blue-light using FAD |
![]() | Protein Blue light receptor BlrB [143365] (1 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [143366] (1 PDB entry) Uniprot Q3IYE4 1-136 |
![]() | Domain d2byca1: 2byc A:1-136 [129476] Other proteins in same PDB: d2byca2, d2bycb3 complexed with fmn |
PDB Entry: 2byc (more details), 1.9 Å
SCOPe Domain Sequences for d2byca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2byca1 d.58.10.2 (A:1-136) Blue light receptor BlrB {Rhodobacter sphaeroides [TaxId: 1063]} mdelvsltyrsrvrladpvadivqimrasrvrnlrlgitgillyngvhfvqtiegprsac delfrlisadprhqeilafdlepitarrfpdwsmrivsrkelralapdlerldlsgpedv aelhrtiaaslsrgda
Timeline for d2byca1: