SCOPe 2.01: Domain d2bybb1: 2byb B:6-289,B:402-496

Lineage for d2bybb1 (2byb B:6-289,B:402-496)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Monoamine oxidase B [69423] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [102180] (14 PDB entries)

8. Domain d2bybb1: 2byb B:6-289,B:402-496 [129474]
   Other proteins in same PDB: d2byba2, d2bybb2
   automatically matched to d1o5wc1
   complexed with dpk, fad

Details for d2bybb1

PDB Entry: 2byb, 2.2 Å

PDB Description: human monoamine oxidase b in complex with deprenyl

PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d2bybb1:

Sequence; same for both SEQRES and ATOM records:

>d2bybb1 c.3.1.2 (B:6-289,B:402-496) Monoamine oxidase B {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgptq
nrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmddm
greipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsalwf
lwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtrenv
lvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrvlrq
pvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqp
itttflerhlpsvpgllrli

Timeline for d2bybb1:

• d2bybb1 first appeared in SCOP 1.73
  
• d2bybb1 appears in SCOP 1.75
  
• d2bybb1 appears in SCOPe 2.02
  
• d2bybb1 appears in the current release, SCOPe 2.08