Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein automated matches [190044] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187001] (7 PDB entries) |
Domain d2by8x_: 2by8 X: [129469] automated match to d1tgsz_ complexed with bam, ca, gol, so4 |
PDB Entry: 2by8 (more details), 1.3 Å
SCOPe Domain Sequences for d2by8x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2by8x_ b.47.1.2 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d2by8x_: