Lineage for d2by8x_ (2by8 X:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 954551Protein automated matches [190044] (7 species)
    not a true protein
  7. 954562Species Cow (Bos taurus) [TaxId:9913] [187001] (7 PDB entries)
  8. 954567Domain d2by8x_: 2by8 X: [129469]
    automated match to d1tgsz_
    complexed with bam, ca, gol, so4

Details for d2by8x_

PDB Entry: 2by8 (more details), 1.3 Å

PDB Description: is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
PDB Compounds: (X:) cationic trypsin

SCOPe Domain Sequences for d2by8x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2by8x_ b.47.1.2 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d2by8x_:

Click to download the PDB-style file with coordinates for d2by8x_.
(The format of our PDB-style files is described here.)

Timeline for d2by8x_: