Lineage for d2by7x_ (2by7 X:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796823Protein automated matches [190044] (14 species)
    not a true protein
  7. 2796835Species Cow (Bos taurus) [TaxId:9913] [187001] (23 PDB entries)
  8. 2796842Domain d2by7x_: 2by7 X: [129468]
    automated match to d1tgsz_
    complexed with bam, ca, gol, so4

Details for d2by7x_

PDB Entry: 2by7 (more details), 1.3 Å

PDB Description: is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
PDB Compounds: (X:) cationic trypsin

SCOPe Domain Sequences for d2by7x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2by7x_ b.47.1.2 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d2by7x_:

Click to download the PDB-style file with coordinates for d2by7x_.
(The format of our PDB-style files is described here.)

Timeline for d2by7x_: