![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein automated matches [190044] (14 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187001] (23 PDB entries) |
![]() | Domain d2by5x_: 2by5 X: [129466] automated match to d1tgsz_ complexed with bam, ca, gol, so4 |
PDB Entry: 2by5 (more details), 1.3 Å
SCOPe Domain Sequences for d2by5x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2by5x_ b.47.1.2 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d2by5x_: