![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (2 species) contains an additional N-terminal domain |
![]() | Species Deinococcus radiodurans [TaxId:1299] [141769] (9 PDB entries) Uniprot Q9RX51 111-528 |
![]() | Domain d2by3a3: 2by3 A:111-530 [129465] Other proteins in same PDB: d2by3a1, d2by3a2 automated match to d2bhua3 complexed with bme, glc, mg, trs has additional subdomain(s) that are not in the common domain |
PDB Entry: 2by3 (more details), 1.5 Å
SCOPe Domain Sequences for d2by3a3:
Sequence, based on SEQRES records: (download)
>d2by3a3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} tfdwtdadwhgikladcvfyevhvgtftpegtyraaaeklpylkelgvtaiqvmplaafd gqrgwgydgaafyapyapygrpedlmalvdaahrlglgvfldvvynhfgpsgnylssyap syftdrfssawgmgldyaephmrryvtgnarmwlrdyhfdglrldatpymtddsethilt elaqeihelggthlllaedhrnlpdlvtvnhldgiwtddfhhetrvtltgeqegyyagyr ggaealaytirrgwryegqfwavkgeeherghpsdaleapnfvyciqnhdqignrplger lhqsdgvtlheyrgaaallltlpmtpllfqgqewaastpfqffsdhagelgqavsegrkk efggfsgfsgedvpdpqaeqtflnsklnwaereggehartlrlyrdllrlrredpvlhnr
>d2by3a3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} tfdwtdadwhgikladcvfyevhvgtftpegtyraaaeklpylkelgvtaiqvmplaafd gqrgwgydgaafyapyapygrpedlmalvdaahrlglgvfldvvynhfgpsgnylssyap syftdrfssawgmgldyaephmrryvtgnarmwlrdyhfdglrldatpymtddsethilt elaqeihelggthlllaedhrnlpdlvtvnhldgiwtddfhhetrvtltgeqegyyagyr ggaealaytirrgwryegqfwavkgeeherghpsdaleapnfvyciqnhdqignrplger lhqsdgvtlheyrgaaallltlpmtpllfqgqewaastpfqffsdhagelgqavsegrkk efdvpdpqaeqtflnsklnwaereggehartlrlyrdllrlrredpvlhnr
Timeline for d2by3a3: