Lineage for d2by3a1 (2by3 A:14-110)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species)
    domain architecture similar to isoamylase
  7. Species Deinococcus radiodurans [TaxId:1299] [141019] (9 PDB entries)
    Uniprot Q9RX51 14-110
  8. Domain d2by3a1: 2by3 A:14-110 [129463]
    Other proteins in same PDB: d2by3a2, d2by3a3
    automated match to d2bhua1
    complexed with bme, glc, mg, trs

Details for d2by3a1

PDB Entry: 2by3 (more details), 1.5 Å

PDB Description: is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d2by3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2by3a1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]}
sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv
gpgarylfvldgvptpdpyarflpdgvhgeaevvdfg

SCOPe Domain Coordinates for d2by3a1 are not available.

Timeline for d2by3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2by3a2, d2by3a3