| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
| Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species) domain architecture similar to isoamylase |
| Species Deinococcus radiodurans [TaxId:1299] [141019] (9 PDB entries) |
| Domain d2by2a1: 2by2 A:14-110 [129460] Other proteins in same PDB: d2by2a2, d2by2a3 automatically matched to 2BHU A:14-110 complexed with bme, glc, mg, tre, trs |
PDB Entry: 2by2 (more details), 1.5 Å
SCOP Domain Sequences for d2by2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2by2a1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]}
sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv
gpgarylfvldgvptpdpyarflpdgvhgeaevvdfg
Timeline for d2by2a1: