![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Glycosyltrehalose trehalohydrolase [51034] (2 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [141553] (9 PDB entries) |
![]() | Domain d2by0a2: 2by0 A:531-602 [129455] Other proteins in same PDB: d2by0a1, d2by0a3 automatically matched to 2BHU A:531-602 complexed with bme, glc, mg, tre, trs |
PDB Entry: 2by0 (more details), 1.55 Å
SCOP Domain Sequences for d2by0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2by0a2 b.71.1.1 (A:531-602) Glycosyltrehalose trehalohydrolase {Deinococcus radiodurans [TaxId: 1299]} qrenlttghdgdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegred ltlgageavlvg
Timeline for d2by0a2: