Class b: All beta proteins [48724] (178 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Glycosyltrehalose trehalohydrolase [51034] (2 species) |
Species Deinococcus radiodurans [TaxId:1299] [141553] (9 PDB entries) Uniprot Q9RX51 529-600 |
Domain d2bxza2: 2bxz A:531-602 [129452] Other proteins in same PDB: d2bxza1, d2bxza3 automated match to d2bhua2 complexed with bme, glc, mg, tre, trs |
PDB Entry: 2bxz (more details), 1.75 Å
SCOPe Domain Sequences for d2bxza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxza2 b.71.1.1 (A:531-602) Glycosyltrehalose trehalohydrolase {Deinococcus radiodurans [TaxId: 1299]} qrenlttghdgdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegred ltlgageavlvg
Timeline for d2bxza2: