![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Glycosyltrehalose trehalohydrolase [51034] (2 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [141553] (9 PDB entries) Uniprot Q9RX51 529-600 |
![]() | Domain d2bxya2: 2bxy A:531-602 [129449] Other proteins in same PDB: d2bxya1, d2bxya3 automated match to d2bhua2 complexed with bme, glc, mg, tre, trs |
PDB Entry: 2bxy (more details), 1.75 Å
SCOPe Domain Sequences for d2bxya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxya2 b.71.1.1 (A:531-602) Glycosyltrehalose trehalohydrolase {Deinococcus radiodurans [TaxId: 1299]} qrenlttghdgdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegred ltlgageavlvg
Timeline for d2bxya2: