Lineage for d2bxya1 (2bxy A:14-110)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770292Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1770435Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species)
    domain architecture similar to isoamylase
  7. 1770436Species Deinococcus radiodurans [TaxId:1299] [141019] (9 PDB entries)
    Uniprot Q9RX51 14-110
  8. 1770444Domain d2bxya1: 2bxy A:14-110 [129448]
    Other proteins in same PDB: d2bxya2, d2bxya3
    automated match to d2bhua1
    complexed with bme, glc, mg, tre, trs

Details for d2bxya1

PDB Entry: 2bxy (more details), 1.75 Å

PDB Description: is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d2bxya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bxya1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]}
sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv
gpgarylfvldgvptpdpyarflpdgvhgeaevvdfg

SCOPe Domain Coordinates for d2bxya1:

Click to download the PDB-style file with coordinates for d2bxya1.
(The format of our PDB-style files is described here.)

Timeline for d2bxya1: