SCOPe 2.08: Domain d2bxxb_: 2bxx B:

Lineage for d2bxxb_ (2bxx B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.148: Coronavirus RNA-binding domain [110303] (1 superfamily)
   coiled antiparallel beta-sheet of 5 strands, order 51324; complex topology, crossing loops

4. Superfamily b.148.1: Coronavirus RNA-binding domain [110304] (1 family)
   automatically mapped to Pfam PF00937

5. Family b.148.1.1: Coronavirus RNA-binding domain [110305] (1 protein)
   N-terminal part of Pfam PF00937

6. Protein Nucleocapsid protein [110306] (2 species)

7. Species Avian infectious bronchitis virus [TaxId:11120] [141560] (4 PDB entries)
   Uniprot P32923 23-160! Uniprot P69596 29-160! Uniprot P69597 29-160
   different strains

8. Domain d2bxxb_: 2bxx B: [129447]
   automated match to d2bxxa1

Details for d2bxxb_

PDB Entry: 2bxx, 1.85 Å

PDB Description: crystal structure of the n-terminal domain of ibv coronavirus nucleocapsid. native crystal form

PDB Compounds: (B:) nucleocapsid protein

SCOPe Domain Sequences for d2bxxb_:

Sequence; same for both SEQRES and ATOM records:

>d2bxxb_ b.148.1.1 (B:) Nucleocapsid protein {Avian infectious bronchitis virus [TaxId: 11120]}
hmssgnaswfqaikakklntpppkfegsgvpdnenikpsqqhgywrrqarfkpgkggrcp
vpdawyfyytgtgpaadlnwgdtqdgivwvaakgadtksrsnqgtrdpdkfdqyplrfsd
ggpdgnfrwdfipl

Timeline for d2bxxb_:

• d2bxxb_ first appeared in SCOP 1.73, called d2bxxb1
  
• d2bxxb_ appears in SCOPe 2.07