![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.148: Coronavirus RNA-binding domain [110303] (1 superfamily) coiled antiparallel beta-sheet of 5 strands, order 51324; complex topology, crossing loops |
![]() | Superfamily b.148.1: Coronavirus RNA-binding domain [110304] (1 family) ![]() automatically mapped to Pfam PF00937 |
![]() | Family b.148.1.1: Coronavirus RNA-binding domain [110305] (1 protein) N-terminal part of Pfam PF00937 |
![]() | Protein Nucleocapsid protein [110306] (2 species) |
![]() | Species Avian infectious bronchitis virus [TaxId:11120] [141560] (4 PDB entries) Uniprot P32923 23-160! Uniprot P69596 29-160! Uniprot P69597 29-160 different strains |
![]() | Domain d2bxxb_: 2bxx B: [129447] automated match to d2bxxa1 |
PDB Entry: 2bxx (more details), 1.85 Å
SCOPe Domain Sequences for d2bxxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxxb_ b.148.1.1 (B:) Nucleocapsid protein {Avian infectious bronchitis virus [TaxId: 11120]} hmssgnaswfqaikakklntpppkfegsgvpdnenikpsqqhgywrrqarfkpgkggrcp vpdawyfyytgtgpaadlnwgdtqdgivwvaakgadtksrsnqgtrdpdkfdqyplrfsd ggpdgnfrwdfipl
Timeline for d2bxxb_: