Lineage for d2bxqa2 (2bxq A:389-584)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. Protein automated matches [254493] (6 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries)
  8. Domain d2bxqa2: 2bxq A:389-584 [129444]
    automated match to d4emxa3
    complexed with imn, myr, p1z

Details for d2bxqa2

PDB Entry: 2bxq (more details), 2.6 Å

PDB Description: human serum albumin complexed with myristate, phenylbutazone and indomethacin
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d2bxqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bxqa2 a.126.1.0 (A:389-584) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekeeqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaalg

SCOPe Domain Coordinates for d2bxqa2 are not available.

Timeline for d2bxqa2:

Domains from same chain:
(mouse over for more information)
d2bxqa1, d2bxqa3