| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (1 family) ![]() |
| Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
| Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
| Species Human (Homo sapiens) [TaxId:9606] [48555] (46 PDB entries) |
| Domain d2bxpa2: 2bxp A:389-582 [129442] automatically matched to d1bj5_3 complexed with myr, p1z |
PDB Entry: 2bxp (more details), 2.3 Å
SCOP Domain Sequences for d2bxpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxpa2 a.126.1.1 (A:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa
Timeline for d2bxpa2: