Lineage for d2bxoa2 (2bxo A:389-584)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730254Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2730255Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2730256Species Human (Homo sapiens) [TaxId:9606] [48555] (96 PDB entries)
    Uniprot P02768 29-596
  8. 2730593Domain d2bxoa2: 2bxo A:389-584 [129440]
    automated match to d1n5ua3
    complexed with myr, opb

Details for d2bxoa2

PDB Entry: 2bxo (more details), 2.6 Å

PDB Description: human serum albumin complexed with myristate and oxyphenbutazone
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d2bxoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bxoa2 a.126.1.1 (A:389-584) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaalg

SCOPe Domain Coordinates for d2bxoa2:

Click to download the PDB-style file with coordinates for d2bxoa2.
(The format of our PDB-style files is described here.)

Timeline for d2bxoa2: