SCOP 1.73: Domain d2bxna2: 2bxn A:389-582

Lineage for d2bxna2 (2bxn A:389-582)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (46 PDB entries)

8. Domain d2bxna2: 2bxn A:389-582 [129438]
   automatically matched to d1bj5_3
   complexed with idb, myr

Details for d2bxna2

PDB Entry: 2bxn, 2.65 Å

PDB Description: human serum albumin complexed with myristate and iodipamide

PDB Compounds: (A:) serum albumin

SCOP Domain Sequences for d2bxna2:

Sequence; same for both SEQRES and ATOM records:

>d2bxna2 a.126.1.1 (A:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

Timeline for d2bxna2:

• d2bxna2 is new in SCOP 1.73
  
• d2bxna2 appears in SCOP 1.75
  
• d2bxna2 appears in the current release, SCOPe 2.08