| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (1 family) ![]() |
| Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
| Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
| Species Human (Homo sapiens) [TaxId:9606] [48555] (46 PDB entries) |
| Domain d2bxka1: 2bxk A:207-378 [129431] automatically matched to d1n5ua1 complexed with azq, imn, myr |
PDB Entry: 2bxk (more details), 2.4 Å
SCOP Domain Sequences for d2bxka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxka1 a.126.1.1 (A:207-378) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
gerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecaddradlakyice
nqdsissklkeccekpllekshciaevendempadlpslaadfveskdvcknyaeakdvf
lgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfdefk
Timeline for d2bxka1: