Lineage for d2bxgb2 (2bxg B:389-582)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648331Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 648332Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 648333Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 648334Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 648335Species Human (Homo sapiens) [TaxId:9606] [48555] (46 PDB entries)
  8. 648432Domain d2bxgb2: 2bxg B:389-582 [129428]
    automatically matched to d1bj5_3
    complexed with ibp

Details for d2bxgb2

PDB Entry: 2bxg (more details), 2.7 Å

PDB Description: human serum albumin complexed with ibuprofen
PDB Compounds: (B:) serum albumin

SCOP Domain Sequences for d2bxgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bxgb2 a.126.1.1 (B:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

SCOP Domain Coordinates for d2bxgb2:

Click to download the PDB-style file with coordinates for d2bxgb2.
(The format of our PDB-style files is described here.)

Timeline for d2bxgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bxgb1