Lineage for d2bxgb1 (2bxg B:207-378)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777088Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 777089Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 777090Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 777091Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 777092Species Human (Homo sapiens) [TaxId:9606] [48555] (50 PDB entries)
    Uniprot P02768 29-596
  8. 777176Domain d2bxgb1: 2bxg B:207-378 [129427]
    automatically matched to d1n5ua1
    complexed with ibp

Details for d2bxgb1

PDB Entry: 2bxg (more details), 2.7 Å

PDB Description: human serum albumin complexed with ibuprofen
PDB Compounds: (B:) serum albumin

SCOP Domain Sequences for d2bxgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bxgb1 a.126.1.1 (B:207-378) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
gerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecaddradlakyice
nqdsissklkeccekpllekshciaevendempadlpslaadfveskdvcknyaeakdvf
lgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfdefk

SCOP Domain Coordinates for d2bxgb1:

Click to download the PDB-style file with coordinates for d2bxgb1.
(The format of our PDB-style files is described here.)

Timeline for d2bxgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bxgb2