SCOPe 2.07: Domain d2bxfb2: 2bxf B:389-582

Lineage for d2bxfb2 (2bxf B:389-582)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (93 PDB entries)
   Uniprot P02768 29-596

8. Domain d2bxfb2: 2bxf B:389-582 [129424]
   automated match to d1n5ua3
   complexed with dzp

Details for d2bxfb2

PDB Entry: 2bxf, 2.95 Å

PDB Description: human serum albumin complexed with diazepam

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d2bxfb2:

Sequence; same for both SEQRES and ATOM records:

>d2bxfb2 a.126.1.1 (B:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

Timeline for d2bxfb2:

• d2bxfb2 first appeared in SCOP 1.73
  
• d2bxfb2 appears in SCOPe 2.06
  
• d2bxfb2 appears in the current release, SCOPe 2.08