Lineage for d2bxcb1 (2bxc B:207-378)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648331Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 648332Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 648333Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 648334Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 648335Species Human (Homo sapiens) [TaxId:9606] [48555] (46 PDB entries)
  8. 648472Domain d2bxcb1: 2bxc B:207-378 [129411]
    automatically matched to d1n5ua1
    complexed with p1z

Details for d2bxcb1

PDB Entry: 2bxc (more details), 3.1 Å

PDB Description: human serum albumin complexed with phenylbutazone
PDB Compounds: (B:) serum albumin

SCOP Domain Sequences for d2bxcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bxcb1 a.126.1.1 (B:207-378) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
gerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecaddradlakyice
nqdsissklkeccekpllekshciaevendempadlpslaadfveskdvcknyaeakdvf
lgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfdefk

SCOP Domain Coordinates for d2bxcb1:

Click to download the PDB-style file with coordinates for d2bxcb1.
(The format of our PDB-style files is described here.)

Timeline for d2bxcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bxcb2