SCOP 1.73: Domain d2bxca1: 2bxc A:207-378

Lineage for d2bxca1 (2bxc A:207-378)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (46 PDB entries)

8. Domain d2bxca1: 2bxc A:207-378 [129409]
   automatically matched to d1n5ua1
   complexed with p1z

Details for d2bxca1

PDB Entry: 2bxc, 3.1 Å

PDB Description: human serum albumin complexed with phenylbutazone

PDB Compounds: (A:) serum albumin

SCOP Domain Sequences for d2bxca1:

Sequence; same for both SEQRES and ATOM records:

>d2bxca1 a.126.1.1 (A:207-378) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
gerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecaddradlakyice
nqdsissklkeccekpllekshciaevendempadlpslaadfveskdvcknyaeakdvf
lgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfdefk

Timeline for d2bxca1:

• d2bxca1 is new in SCOP 1.73
  
• d2bxca1 appears in SCOP 1.75
  
• d2bxca1 appears in the current release, SCOPe 2.08