Lineage for d2bxba1 (2bxb A:207-378)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. Species Human (Homo sapiens) [TaxId:9606] [48555] (93 PDB entries)
    Uniprot P02768 29-596
  8. Domain d2bxba1: 2bxb A:207-378 [129405]
    automatically matched to d1n5ua1
    complexed with opb

Details for d2bxba1

PDB Entry: 2bxb (more details), 3.2 Å

PDB Description: human serum albumin complexed with oxyphenbutazone
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d2bxba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bxba1 a.126.1.1 (A:207-378) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
gerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecaddradlakyice
nqdsissklkeccekpllekshciaevendempadlpslaadfveskdvcknyaeakdvf
lgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfdefk

SCOPe Domain Coordinates for d2bxba1 are not available.

Timeline for d2bxba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bxba2
View in 3D
Domains from other chains:
(mouse over for more information)
d2bxbb1, d2bxbb2