SCOPe 2.06: Domain d2bxab2: 2bxa B:389-582

Lineage for d2bxab2 (2bxa B:389-582)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (78 PDB entries)
   Uniprot P02768 29-596

8. Domain d2bxab2: 2bxa B:389-582 [129404]
   automated match to d1n5ua3
   complexed with c1f

Details for d2bxab2

PDB Entry: 2bxa, 2.35 Å

PDB Description: human serum albumin complexed with 3-carboxy-4-methyl-5-propyl-2-furanpropanoic acid (cmpf)

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d2bxab2:

Sequence; same for both SEQRES and ATOM records:

>d2bxab2 a.126.1.1 (B:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

Timeline for d2bxab2:

• d2bxab2 first appeared in SCOP 1.73
  
• d2bxab2 appears in SCOPe 2.05
  
• d2bxab2 appears in SCOPe 2.07
  
• d2bxab2 appears in the current release, SCOPe 2.08