SCOP 1.75: Domain d2bx8b1: 2bx8 B:207-378

Lineage for d2bx8b1 (2bx8 B:207-378)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (50 PDB entries)
   Uniprot P02768 29-596

8. Domain d2bx8b1: 2bx8 B:207-378 [129399]
   automatically matched to d1n5ua1
   complexed with azq

Details for d2bx8b1

PDB Entry: 2bx8, 2.7 Å

PDB Description: human serum albumin complexed with azapropazone

PDB Compounds: (B:) serum albumin

SCOP Domain Sequences for d2bx8b1:

Sequence; same for both SEQRES and ATOM records:

>d2bx8b1 a.126.1.1 (B:207-378) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
gerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecaddradlakyice
nqdsissklkeccekpllekshciaevendempadlpslaadfveskdvcknyaeakdvf
lgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfdefk

Timeline for d2bx8b1:

• d2bx8b1 first appeared in SCOP 1.73
  
• d2bx8b1 appears in SCOPe 2.01
  
• d2bx8b1 appears in the current release, SCOPe 2.08