Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein automated matches [190228] (18 species) not a true protein |
Species Lactococcus lactis [TaxId:1358] [186992] (3 PDB entries) |
Domain d2bx7b_: 2bx7 B: [129396] automated match to d1dora_ complexed with 34d, act, fmn, gol, mg |
PDB Entry: 2bx7 (more details), 2.04 Å
SCOPe Domain Sequences for d2bx7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bx7b_ c.1.4.1 (B:) automated matches {Lactococcus lactis [TaxId: 1358]} mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs iadfhgklksl
Timeline for d2bx7b_: