Lineage for d2bx7b1 (2bx7 B:1-311)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681629Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 681630Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 681670Protein Dihydroorotate dehydrogenase [51397] (7 species)
  7. 681685Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (11 PDB entries)
  8. 681701Domain d2bx7b1: 2bx7 B:1-311 [129396]
    automatically matched to d1dora_
    complexed with 34d, act, fmn, gol, mg

Details for d2bx7b1

PDB Entry: 2bx7 (more details), 2.04 Å

PDB Description: crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,5-dihydroxybenzoate
PDB Compounds: (B:) dihydroorotate dehydrogenase

SCOP Domain Sequences for d2bx7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bx7b1 c.1.4.1 (B:1-311) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOP Domain Coordinates for d2bx7b1:

Click to download the PDB-style file with coordinates for d2bx7b1.
(The format of our PDB-style files is described here.)

Timeline for d2bx7b1: