Lineage for d2bx7b_ (2bx7 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828301Protein automated matches [190228] (20 species)
    not a true protein
  7. 2828330Species Lactococcus lactis [TaxId:1358] [186992] (3 PDB entries)
  8. 2828332Domain d2bx7b_: 2bx7 B: [129396]
    automated match to d1dora_
    complexed with 34d, act, fmn, gol, mg

Details for d2bx7b_

PDB Entry: 2bx7 (more details), 2.04 Å

PDB Description: crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,5-dihydroxybenzoate
PDB Compounds: (B:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d2bx7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bx7b_ c.1.4.1 (B:) automated matches {Lactococcus lactis [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOPe Domain Coordinates for d2bx7b_:

Click to download the PDB-style file with coordinates for d2bx7b_.
(The format of our PDB-style files is described here.)

Timeline for d2bx7b_: