Lineage for d2bwya2 (2bwy A:177-440)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1430452Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 1430453Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 1430454Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 1430455Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 1430456Species Escherichia coli [TaxId:562] [55929] (26 PDB entries)
  8. 1430481Domain d2bwya2: 2bwy A:177-440 [129394]
    Other proteins in same PDB: d2bwya1
    automatically matched to d1a16_2
    complexed with flc, mg, mn, so4

Details for d2bwya2

PDB Entry: 2bwy (more details), 2.4 Å

PDB Description: glu383ala escherichia coli aminopeptidase p
PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d2bwya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwya2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvapglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOPe Domain Coordinates for d2bwya2:

Click to download the PDB-style file with coordinates for d2bwya2.
(The format of our PDB-style files is described here.)

Timeline for d2bwya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bwya1