Lineage for d2bwxa2 (2bwx A:177-440)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732939Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 732940Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 732941Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 732942Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 732946Species Escherichia coli [TaxId:562] [55929] (23 PDB entries)
  8. 732948Domain d2bwxa2: 2bwx A:177-440 [129392]
    Other proteins in same PDB: d2bwxa1
    automatically matched to d1a16_2
    complexed with cl, mn; mutant

Details for d2bwxa2

PDB Entry: 2bwx (more details), 1.7 Å

PDB Description: his354ala escherichia coli aminopeptidase p
PDB Compounds: (A:) aminopeptidase p

SCOP Domain Sequences for d2bwxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwxa2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglsawl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOP Domain Coordinates for d2bwxa2:

Click to download the PDB-style file with coordinates for d2bwxa2.
(The format of our PDB-style files is described here.)

Timeline for d2bwxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bwxa1