Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) |
Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins) |
Protein automated matches [254492] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [255066] (7 PDB entries) |
Domain d2bwxa1: 2bwx A:1-176 [129391] Other proteins in same PDB: d2bwxa2 automated match to d2v3za1 complexed with cl, mn |
PDB Entry: 2bwx (more details), 1.7 Å
SCOPe Domain Sequences for d2bwxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwxa1 c.55.2.1 (A:1-176) automated matches {Escherichia coli [TaxId: 562]} seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
Timeline for d2bwxa1: