Lineage for d2bwxa1 (2bwx A:1-176)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885765Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) (S)
  5. 2885766Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins)
  6. 2885815Protein automated matches [254492] (1 species)
    not a true protein
  7. 2885816Species Escherichia coli [TaxId:562] [255066] (7 PDB entries)
  8. 2885818Domain d2bwxa1: 2bwx A:1-176 [129391]
    Other proteins in same PDB: d2bwxa2
    automated match to d2v3za1
    complexed with cl, mn

Details for d2bwxa1

PDB Entry: 2bwx (more details), 1.7 Å

PDB Description: his354ala escherichia coli aminopeptidase p
PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d2bwxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwxa1 c.55.2.1 (A:1-176) automated matches {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

SCOPe Domain Coordinates for d2bwxa1:

Click to download the PDB-style file with coordinates for d2bwxa1.
(The format of our PDB-style files is described here.)

Timeline for d2bwxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bwxa2