SCOP 1.73: Domain d2bwwa2: 2bww A:177-440

Lineage for d2bwwa2 (2bww A:177-440)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)

7. Species Escherichia coli [TaxId:562] [55929] (23 PDB entries)

8. Domain d2bwwa2: 2bww A:177-440 [129390]
   Other proteins in same PDB: d2bwwa1
   automatically matched to d1a16_2
   complexed with flc, mg, mn, mrd; mutant

Details for d2bwwa2

PDB Entry: 2bww, 2.61 Å

PDB Description: his350ala escherichia coli aminopeptidase p

PDB Compounds: (A:) aminopeptidase p

SCOP Domain Sequences for d2bwwa2:

Sequence; same for both SEQRES and ATOM records:

>d2bwwa2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmaglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

Timeline for d2bwwa2:

• d2bwwa2 is new in SCOP 1.73
  
• d2bwwa2 appears in SCOP 1.75
  
• d2bwwa2 appears in the current release, SCOPe 2.08