SCOPe 2.08: Domain d2bwwa2: 2bww A:177-440

Lineage for d2bwwa2 (2bww A:177-440)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein automated matches [195197] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255067] (7 PDB entries)

8. Domain d2bwwa2: 2bww A:177-440 [129390]
   Other proteins in same PDB: d2bwwa1
   automated match to d1wl9a2
   complexed with flc, mg, mn, mrd

Details for d2bwwa2

PDB Entry: 2bww, 2.61 Å

PDB Description: his350ala escherichia coli aminopeptidase p

PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d2bwwa2:

Sequence; same for both SEQRES and ATOM records:

>d2bwwa2 d.127.1.1 (A:177-440) automated matches {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmaglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

Timeline for d2bwwa2:

• d2bwwa2 first appeared in SCOP 1.73
  
• d2bwwa2 appears in SCOPe 2.07