Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) |
Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins) |
Domain d2bwwa1: 2bww A:1-176 [129389] Other proteins in same PDB: d2bwwa2 automated match to d2v3za1 complexed with flc, mg, mn, mrd |
PDB Entry: 2bww (more details), 2.61 Å
SCOPe Domain Sequences for d2bwwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwwa1 c.55.2.1 (A:1-176) automated matches {Escherichia coli [TaxId: 562]} seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
Timeline for d2bwwa1: